PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00003.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 295aa    MW: 33636.2 Da    PI: 7.002
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00003.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78e-5281321128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelv++yL++k++++++ +  +++e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nra+ +gyWkat
  Sme2.5_00003.1_g00002.1   8 LPPGFRFHPTDEELVTHYLCRKCTSQPIAV-PIVAEIDLYKFDPWDLPDLALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKAT 92 
                              79*************************999.88***************65556799****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++ +   ++ g+kk Lvfy+g+apkgekt+W+mheyrl
  Sme2.5_00003.1_g00002.1  93 GADKPIGN--PKALGIKKALVFYSGKAPKGEKTNWIMHEYRL 132
                              ******98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-624159IPR003441NAC domain
PROSITE profilePS5100560.7198159IPR003441NAC domain
PfamPF023657.3E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTAAELQLPP GFRFHPTDEE LVTHYLCRKC TSQPIAVPIV AEIDLYKFDP WDLPDLALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGTGYWK ATGADKPIGN PKALGIKKAL VFYSGKAPKG  120
EKTNWIMHEY RLADVDRSAR KNNHSLRLDD WVLCRIYNKK GSIEKHRKLS TSYIDKAGSP  180
VDMKPEILPP LPPPPPPQEL HNDFFYLPSD SVPKIHSDSS CSEHVLSPEF PCEREVQSEQ  240
KLTDWEKTTL DVPFNYMDAT TGATTVDNSL LGSQFQSSYQ MSPLQDMFMH LPKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-82416511174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0498470.0EU049847.1 Solanum tuberosum nam-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234219.10.0Nam-like protein 1
SwissprotQ390131e-135NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB6D1Q30.0B6D1Q3_SOLLC; Nam-like protein 1
STRINGSolyc06g060230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-132NAC family protein